DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plekhm1 and Def8

DIOPT Version :9

Sequence 1:NP_611639.1 Gene:Plekhm1 / 37520 FlyBaseID:FBgn0034694 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_001019945.1 Gene:Def8 / 307973 RGDID:1309008 Length:451 Species:Rattus norvegicus


Alignment Length:476 Identity:126/476 - (26%)
Similarity:202/476 - (42%) Gaps:104/476 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 NEEQTGGDKAE--TNETAEQEAPSGSKTRSRKKSNRQMDSSSFAD-------------------- 322
            :.||...:||:  |:|....|.|:|.....  .|.|.||.....|                    
  Rat    26 HHEQEPNEKAQEVTSEDTLPELPAGEPEFC--YSERMMDLGLSEDHFSRPVGLFLASDVQQLRQA 88

  Fly   323 ------LDLEAPSLLPQGSNSLSNLMQTSWS-GDLEATPTSPTEE------LTGSRFF-QRSVSV 373
                  :.||.|....:..:::..|:..... .:|:    .|.||      |...||: ::|.||
  Rat    89 IEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELK----DPNEEEPNIRVLLEHRFYKEKSKSV 149

  Fly   374 SSSVSLRSPTTDRCSYNALLRKHESNRESGAGWS--EIWEK-----FRASASNLNVAQPQRDTDP 431
            ..       |.|:|  |.::            |.  :.|..     :|..:..||:.     :.|
  Rat   150 KQ-------TCDKC--NTII------------WGLIQTWYTCTGCYYRCHSKCLNLI-----SRP 188

  Fly   432 PISEDLSDLQSLDTNSEFELLTSEFDMVELQQMVAQLCQLAREPGLDAQGFLCKSCQHPLGI-GY 495
            .:|..:|.      .:|:||               .:|.   |.|||:|.:.|..|:.|:.: |.
  Rat   189 CVSSKVSH------QAEYEL---------------NICP---ETGLDSQDYRCAECRAPISLRGV 229

  Fly   496 -SNFQVCAFSGSYYCNSCMDVEMQLIPARIIYNWDFRKYSVSKRAATFLAEFRSHPFLDMQLLNP 559
             |..:.|.::|.|||:.|...::.:||||:::||||....||:.:..:||...|.|.|.::.:||
  Rat   230 PSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINP 294

  Fly   560 RIYFASDAMAELQSLRIRLNFIRAYLYTCAPSSIELLQNQFAGREYLYEHIHLYSIADLALIQRG 624
            .::...:.:.|::.||..:..::.|..||..:....|..|...|::..|:..:|||.||..:..|
  Rat   295 LLFNYVEELVEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSIQDLLEVHMG 359

  Fly   625 VLCQQLQKAFKLGEAHV-LKCRLCHLKGFICEICQSPRVLYPFHISTTFRCLACGAVFHAEC-LN 687
            .|...|.:...:...|: |.|..|..|||:||:|:...||:||. |.|..|..|.||||.:| .:
  Rat   360 RLSCSLTEIHTIFAKHIKLDCERCQAKGFVCELCKEGDVLFPFD-SHTSVCNDCSAVFHRDCYYD 423

  Fly   688 EKQPCPKCERIRKREDQGLQE 708
            ....||||.|:..|:....||
  Rat   424 NSTTCPKCARLTLRKQSLFQE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Plekhm1NP_611639.1 RUN 54..185 CDD:280855
zf-RING_9 500..700 CDD:290612 69/201 (34%)
Def8NP_001019945.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..48 7/21 (33%)
C1_DEF8 134..194 CDD:410369 17/85 (20%)
zf-RING_9 236..433 CDD:404739 68/197 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D177737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.