DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plekhm1 and Plekhm3

DIOPT Version :9

Sequence 1:NP_611639.1 Gene:Plekhm1 / 37520 FlyBaseID:FBgn0034694 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_001034582.1 Gene:Plekhm3 / 241075 MGIID:2443627 Length:761 Species:Mus musculus


Alignment Length:441 Identity:146/441 - (33%)
Similarity:211/441 - (47%) Gaps:70/441 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 RKKSNRQMDSSSFADLDLEAPSLLPQGSNSLSNL-MQTSWS----------------GDLEATPT 355
            :|||:..: :|...|...:..::|..|  :|..| :|.:|.                |.|:..|.
Mouse   341 QKKSSGLL-ASPVLDSPKQYQNILKSG--TLYRLTVQNNWKAFTFVLSKAYLMAFHPGKLDEDPL 402

  Fly   356 SPTEELTGSRFFQRSVSVSSSVSLRSPTTDRCSY-------NALLRKHESNRESGAGWSEIWE-- 411
                         .|.:|...::::....|.|..       ..:||.....|:....|.|..:  
Mouse   403 -------------LSYNVDVCLAVQIDNLDGCDSCFQVIFPQDVLRLRAETRQRAQEWMEALKTA 454

  Fly   412 --KFRASASNLNVAQPQRDTDPPISEDLSDLQSLDTNSEFELLTSEFDMVELQQMVAQLCQLARE 474
              ..|:|..||.|....:      .:|..|.:.|..|....:.||         .::.|..|:.|
Mouse   455 ANAARSSEQNLQVTLRNK------PKDQLDGRELRKNKRQSVTTS---------FLSILTTLSLE 504

  Fly   475 PGLDAQGFLCKSCQHPLGIGYSNFQVCAFSGSYYCNSCMDVEMQLIPARIIYNWDFRKYSVSKRA 539
            .||.||.|.|..||..:|:.....:||.:||.|||:||...:..||||||::|||..||.|||:|
Mouse   505 RGLTAQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQA 569

  Fly   540 ATFLAEFRSHPFLDMQLLNPRIYFASDAMAELQSLRIRLNFIRAYLYTCAPSSIELLQNQFAGRE 604
            ..||......|.:|:|..||.:|..::.:|.:..||.||..:||||::|..:..|.|:.:...||
Mouse   570 KEFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPRE 634

  Fly   605 YLYEHIHLYSIADLALIQRGVLCQQLQKAFKLGEAHVLKCRLCHLKGFICEICQSPRVLYPFHIS 669
            ||.:.|||||:|||..:..|.|...|.|..|...|||..|.||..||||||||.:..:||||...
Mouse   635 YLLQQIHLYSLADLQQVIEGKLAPFLGKVIKFATAHVYSCSLCSQKGFICEICNNGEILYPFEDI 699

  Fly   670 TTFRCLACGAVFHAECLNEKQPCPKCER--IRKRE---------DQGLQEA 709
            :|.||.:||||||:||..:..|||:|.|  ::|::         |:.|:||
Mouse   700 STSRCESCGAVFHSECKEKSVPCPRCVRRELQKKQKSFWRQLNVDESLEEA 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Plekhm1NP_611639.1 RUN 54..185 CDD:280855
zf-RING_9 500..700 CDD:290612 95/201 (47%)
Plekhm3NP_001034582.1 PH_PLEKHM3_1 215..304 CDD:270193
PH-like 364..451 CDD:388408 17/101 (17%)
zf-RING_9 530..727 CDD:372797 94/196 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834928
Domainoid 1 1.000 198 1.000 Domainoid score I3094
eggNOG 1 0.900 - - E1_KOG1829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006834
OrthoInspector 1 1.000 - - otm42944
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12326
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.