DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCND3 and RPL37B

DIOPT Version :10

Sequence 1:NP_004971.2 Gene:KCND3 / 3752 HGNCID:6239 Length:655 Species:Homo sapiens
Sequence 2:NP_010788.1 Gene:RPL37B / 852111 SGDID:S000002908 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:42 Identity:9/42 - (21%)
Similarity:19/42 - (45%) Gaps:5/42 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   533 SPSLSSHPGLTTTCCSRRSKKTTHL-----PNSNLPATRLRS 569
            :||.......:.|.|:|..:::.|:     .:...|:.:.||
Yeast     5 TPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPSAKTRS 46

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCND3NP_004971.2 BTB_POZ_KCND3 6..143 CDD:349726
Interaction with KCNIP1 and KCNIP2. /evidence=ECO:0000269|PubMed:17187064, ECO:0000269|PubMed:34997220 6..21
Interaction with KCNIP1. /evidence=ECO:0000269|PubMed:17187064 70..78
Ion_trans 186..412 CDD:459842
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 367..372
DUF3399 468..563 CDD:463381 6/34 (18%)
Interaction with KCNIP1 and KCNIP2. /evidence=ECO:0000269|PubMed:34997220 470..487
Mediates dendritic targeting. /evidence=ECO:0000250|UniProtKB:Q63881 472..487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..565 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 615..655
RPL37BNP_010788.1 PTZ00073 1..83 CDD:240257 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.