DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13502 and FKBPL

DIOPT Version :10

Sequence 1:NP_611637.1 Gene:CG13502 / 37518 FlyBaseID:FBgn0034692 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_071393.2 Gene:FKBPL / 63943 HGNCID:13949 Length:349 Species:Homo sapiens


Alignment Length:126 Identity:33/126 - (26%)
Similarity:57/126 - (45%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 ALGLKEIKNANPENAIHFFCKALEL----------NSTDINALISRSKCYLLLGEASKALQDAET 220
            |.|.:..:..|||.|...:.:||.|          ..|.::|  :.:.|.||||:...|.|..:.
Human   215 ARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHA--NLAACQLLLGQPQLAAQSCDR 277

  Fly   221 ALGEDKNNIRAIYQKAESLYYLGQFEQSLMFFHRGLRARPE--LALFRLG---VQ-KTQEA 275
            .|..:..:::|:|::..:...||..|::.....:.|...|:  .|...||   :| |.|:|
Human   278 VLEREPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13502NP_611637.1 TPR 150..>277 CDD:440225 33/126 (26%)
TPR repeat 165..189 CDD:276809 7/22 (32%)
TPR repeat 194..224 CDD:276809 9/29 (31%)
TPR repeat 229..257 CDD:276809 5/27 (19%)
FKBPLNP_071393.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..55
TPR 200..>338 CDD:440225 32/124 (26%)
TPR 1 210..243 9/27 (33%)
TPR repeat 210..238 CDD:276809 7/22 (32%)
TPR repeat 251..281 CDD:276809 10/31 (32%)
TPR 2 252..285 10/34 (29%)
TPR 3 286..319 7/32 (22%)
TPR repeat 286..314 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.