DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13502 and odad4

DIOPT Version :9

Sequence 1:NP_611637.1 Gene:CG13502 / 37518 FlyBaseID:FBgn0034692 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_002939085.2 Gene:odad4 / 100145076 XenbaseID:XB-GENE-5960304 Length:574 Species:Xenopus tropicalis


Alignment Length:261 Identity:97/261 - (37%)
Similarity:144/261 - (55%) Gaps:21/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 EADISSVIALGLKEIKNANPENAIHFFCKALELNSTDINALISRSKCYLLLGEASKALQDAETAL 222
            ::..::.:|.|.:....|..:.|...|..||.|...|.|.|::||||:|.||:...||:||||:|
 Frog    12 QSTFATYMAEGEQLYHKAEYKKAKDSFTAALHLQPEDKNCLVARSKCFLKLGDPECALKDAETSL 76

  Fly   223 GEDKNNIRAIYQKAESLYYLGQFEQSLMFFHRGLRARPELALFRLGVQKTQEAIENTIGSKPGPP 287
            ..:|:..:.:|||||:||.:|.||.:|:.:|||.:.|||...||||:||.||||||::|:     
 Frog    77 QIEKDFFKGLYQKAEALYSMGDFEFALVHYHRGYKLRPEFQGFRLGIQKAQEAIENSVGT----- 136

  Fly   288 GPTASVPKSGK------SRKSGEDTPKSQAAGATGTSARTRQKPSRADLER--RNARKLLGELCV 344
              .|||....|      ||:  |::.|::.........:..::..:.|.||  :.||:|||||..
 Frog   137 --PASVKLQNKADLQFISRQ--EESKKAKQKAQVKVQKKDTKQQKKVDPERSQKTARQLLGELYS 197

  Fly   345 DKEYLEKLLLHPDLVRADTHT-ESISAYAREAVEFLNKRQEFWRQQRPCTALPNHKNLPHDALPK 408
            ||||||.||....||..:|.: ..:.......:.:|:.|.||||||:|..|....:.:...   |
 Frog   198 DKEYLESLLRDEALVNGNTRSGVKLHDLIINGILYLDTRTEFWRQQKPIYARERDRKIMQQ---K 259

  Fly   409 W 409
            |
 Frog   260 W 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13502NP_611637.1 TPR repeat 165..189 CDD:276809 6/23 (26%)
ANAPC3 174..252 CDD:289650 35/77 (45%)
TPR repeat 194..224 CDD:276809 17/29 (59%)
TPR repeat 229..257 CDD:276809 14/27 (52%)
odad4XP_002939085.2 TPR repeat 17..43 CDD:276809 6/25 (24%)
PRK15331 <30..95 CDD:357168 29/64 (45%)
TPR repeat 48..78 CDD:276809 17/29 (59%)
TPR repeat 83..111 CDD:276809 14/27 (52%)
TPR repeat 322..348 CDD:276809
TPR repeat 360..388 CDD:276809
TPR_12 361..423 CDD:315987
TPR repeat 393..432 CDD:276809
MDN1 <409..567 CDD:227596
TPR repeat 437..465 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12860
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1417967at2759
OrthoFinder 1 1.000 - - FOG0008154
OrthoInspector 1 1.000 - - oto105226
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6115
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.