DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synj and INP54

DIOPT Version :9

Sequence 1:NP_001246454.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_014576.1 Gene:INP54 / 854089 SGDID:S000005426 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:361 Identity:93/361 - (25%)
Similarity:142/361 - (39%) Gaps:93/361 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 RVAVGTYNVNGGKHFRSIVFKDSLADWLLDCHALARSKALVDVNNPSENVDHPV----------D 593
            :|:|.|:|.  ||.|                 .:..|||:|      :.:..|.          |
Yeast     7 KVSVTTFNC--GKEF-----------------PVENSKAIV------KQLLFPYDDGISQLELQD 46

  Fly   594 IYAIGFEEIVDLNASNIMAASTD-------------NAKLWAEELQKTISRDNDYVLLTYQQLVG 645
            :|.:||:|:|.:...:..|.:.|             |.|:.|.:      .|..|..|....| |
Yeast    47 LYVLGFQEVVPIWQGSFPAVNRDLIDRITTTAVNCLNEKVSATQ------GDEQYSCLGVNSL-G 104

  Fly   646 VCLYIYIRPEHAPHIRDVAIDCVK-TGLGGATGN--KGACAIRFVL------HGTSMCFVCAHFA 701
            ....|.:...:|..::|   |.:| .|..|..|.  ||...|.|.:      :.....::|||..
Yeast   105 AITIIVLYNNNALKVKD---DILKRNGKCGWFGTHLKGGTLISFQMTRNGEENWERFSYICAHLN 166

  Fly   702 AGQSQVAERNADYAEITRKLAFPMGRTLKSHDWVFWCGDFNYRIDMEKD---------ELKECVR 757
            |.:. |..||....:..|.::......:...|..|:.||.|:|:....|         .|:..:.
Yeast   167 ANEG-VNNRNQRIDDYKRIMSEVCDSEVAKSDHFFFLGDLNFRVTSTYDPTTNYSSTTTLRRLLE 230

  Fly   758 NGDLSTVLEFDQLRKEQEAGNVFGEFLEGEITFDPTYKYDLFSDDYDTSEKQRAPAWTDRVLWRR 822
            |.:     |.:.|||.::.....| |.|.:|||.||||:.||  :.:|...:|.|:|.||:|:  
Yeast   231 NHE-----ELNLLRKGEDEPLCKG-FQELKITFPPTYKFKLF--EKETYNTKRIPSWCDRILY-- 285

  Fly   823 RKALAEGDFAASAWNPGKLIHYGRSE-LKQSDHRPV 857
             |:.|...||    ..|......||. |..|||:||
Yeast   286 -KSYAVPTFA----QEGTYHSVPRSNALLFSDHQPV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SynjNP_001246454.1 Syja_N 61..353 CDD:280532
INPP5c_Synj 538..863 CDD:197323 93/361 (26%)
DUF1866 862..1008 CDD:286093
INP54NP_014576.1 COG5411 1..371 CDD:227698 93/361 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.