DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synj and 5PTASE11

DIOPT Version :9

Sequence 1:NP_001246454.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_175182.2 Gene:5PTASE11 / 841160 AraportID:AT1G47510 Length:334 Species:Arabidopsis thaliana


Alignment Length:354 Identity:101/354 - (28%)
Similarity:159/354 - (44%) Gaps:57/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 LC--KRYTEYVRPRMARVAVGTYNVNGGKH--FRSIVFKDSLADWLLDCHALARSKALVDVN--N 583
            :|  ||:     |...:..:|::..|...|  .::|...:|       |....::...:.:.  |
plant    10 MCGLKRF-----PNYKKSPIGSFAKNSSSHDGIKTIEAVNS-------CSFSRKADLCIRIITWN 62

  Fly   584 PSENVDHPVDIYAIGFEEIVDLNASNIMAASTDNAKLWAEELQKTISRDNDYVLLTYQQLVGVCL 648
            .:.||.:...:..:|.|...||....:..|...|    .::|.:|.|... :.||...:|..|.|
plant    63 MNGNVSYEDLVELVGKERKFDLLVVGLQEAPKAN----VDQLLQTASSPT-HELLGKAKLQSVQL 122

  Fly   649 YIYIRPEHAPHIRDVAIDCVKTGLGGATG----NKGACAIRFVLHGTSMCFVCAHFAAGQSQVAE 709
            |:: .|::: |.....:...:..:||..|    .|||.|||.......|.|:..|.:|...:|.:
plant   123 YLF-GPKNS-HTLVKELKAERYSVGGCGGLIGRKKGAVAIRINYDDIKMVFISCHLSAHAKKVDQ 185

  Fly   710 RNADYAEITRKLAFPMGRTLKSHDWVFWCGDFNYRI-DMEKDELKECVRNGDLSTVLEFDQLRKE 773
            ||.:...|...|   :.|..:..|...|.||.|||| |:....::..::|...|.::..|||.:|
plant   186 RNTELRHIANSL---LPRDKRKRDLTVWLGDLNYRIQDVSNHPVRSLIQNHLQSVLVSKDQLLQE 247

  Fly   774 QEAGNVFGEFLEGEITFDPTYKYDLFSDDYDTSEKQRAPAWTDRVLWRRRKALAEGDFAASAWNP 838
            .|.|.:|..:.||.:.|.|||||::.|.|||||.|.|.||||||:|::    :.:.|      |.
plant   248 AERGEIFKGYSEGTLGFKPTYKYNVGSSDYDTSHKIRVPAWTDRILFK----IQDTD------NI 302

  Fly   839 GKLIH--------YGRSELKQSDHRPVIA 859
            ...:|        ||      |||:||.|
plant   303 QATLHSYDSIDQVYG------SDHKPVKA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SynjNP_001246454.1 Syja_N 61..353 CDD:280532
INPP5c_Synj 538..863 CDD:197323 97/339 (29%)
DUF1866 862..1008 CDD:286093
5PTASE11NP_175182.2 EEP 56..325 CDD:294334 90/294 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.