DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synj and AT2G37440

DIOPT Version :9

Sequence 1:NP_001246454.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001323804.1 Gene:AT2G37440 / 818321 AraportID:AT2G37440 Length:479 Species:Arabidopsis thaliana


Alignment Length:388 Identity:127/388 - (32%)
Similarity:182/388 - (46%) Gaps:92/388 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 RVAVGTYNVNGGKHFRSIVFKDSLADWLLDCHALARSKALVDVNNPSENVDHPVDIYAIGFEEIV 603
            ::.|||:||.|......:    .|.|||               .:|::     .|||.:||:|||
plant    84 KMFVGTWNVGGKSPHEGL----DLKDWL---------------KSPAD-----ADIYVLGFQEIV 124

  Fly   604 DLNASNIMAASTDN--AKLWAEELQKTISRDND-------------------------------- 634
            .|||.|::.|. ||  |..|...:::.::..|:                                
plant   125 PLNAGNVLGAE-DNGPAAKWLSLIREALNNTNNLSPNELEHTKSSQQPRFSFSGLSDDTPIPCNS 188

  Fly   635 -----YVLLTYQQLVGVCLYIYIRPEHAPHIRDVAIDCVKTGLGGATGNKGACAIRFVLHGTSMC 694
                 |.|...:|:||:.|.:::|.:....|.::.:.||..|:.|..||||:.:|...||.||:|
plant   189 TPPRGYSLAASKQMVGIFLCVWVRDDLRKRITNLKVSCVGRGIMGYLGNKGSVSISMSLHETSLC 253

  Fly   695 FVCAHFAAGQSQVAE--RNADYAEITRKLAFPMG------RTLKSHDWVFWCGDFNYRIDMEKDE 751
            |||.|..:|:.:..|  ||.|..||.::..|...      .|:..||.|.|.||.|||:....| 
plant   254 FVCTHLTSGEKEGDELRRNLDVTEIFKRTRFSRSSKDSRPETIMDHDKVIWLGDLNYRLRASSD- 317

  Fly   752 LKECVRNGDLSTVLEFDQLRKEQEAGNVFGEFLEGEITFDPTYKYDLFSDDY-----DTSEKQRA 811
            |.|.:||.|..::||.|||:.||.||.:|..:.||:|.|.|||||.:.||:|     .:.||:|.
plant   318 LHEQLRNHDWESLLEKDQLKIEQRAGRIFKGWEEGKIYFAPTYKYRINSDNYVVQTEKSKEKRRT 382

  Fly   812 PAWTDRVLWRRRKALAEGDFAASAWNPGKLIHYGRSELKQSDHRPVIAIIDAEIMEIDQQRRR 874
            |||.||:||:       ||.....|       |.|.|.|.||||||.::....|...:|..|:
plant   383 PAWCDRILWK-------GDGMKQLW-------YVRGESKFSDHRPVQSLFSVHIDLKNQSNRK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SynjNP_001246454.1 Syja_N 61..353 CDD:280532
INPP5c_Synj 538..863 CDD:197323 124/375 (33%)
DUF1866 862..1008 CDD:286093 3/13 (23%)
AT2G37440NP_001323804.1 EEP 6..424 CDD:412407 125/379 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 198 1.000 Domainoid score I884
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.