DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synj and Sh2d1b2

DIOPT Version :10

Sequence 1:NP_569729.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001028671.1 Gene:Sh2d1b2 / 545378 MGIID:3622649 Length:132 Species:Mus musculus


Alignment Length:185 Identity:37/185 - (20%)
Similarity:62/185 - (33%) Gaps:87/185 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 DVPHVVFDYH-----QECRG--------GNFSALAKLKERIVACGA------------NYGVFHA 379
            |:|:    ||     :||..        |||  |.:..|.:.  ||            ||.:|..
Mouse     2 DLPY----YHGCLTKRECEALLLKGGVDGNF--LIRDSESVP--GALCLCVSFKKLVYNYRIFRE 58

  Fly   380 SNGQVLREQFGVVRTNCLDCLDRTNCVQTYLGLD-------TLGIQLEALKMGGKQQNISRFEEI 437
            .||                          |..::       |:...||.|        ||:|:..
Mouse    59 KNG--------------------------YYRIETEPSTPKTIFPNLEEL--------ISKFKTP 89

  Fly   438 FRQMWINNGNEVSKIYAGTGAIQGGSKLMDGARSAARTIQNNLLDNSKQEAIDVL 492
            .:.|.::..|.:.:    :|...|..:|         .::.|:.:|:.:|.:|||
Mouse    90 GQGMVVHLSNPIMR----SGFCPGARRL---------NLEANVYENTDEEYVDVL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SynjNP_569729.1 COG5329 61..493 CDD:227637 37/185 (20%)
INPP5c_Synj 538..863 CDD:197323
DUF1866 862..1008 CDD:286093
Sh2d1b2NP_001028671.1 SH2_SAP1 1..103 CDD:198205 28/142 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.