DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synj and Inpp5k

DIOPT Version :9

Sequence 1:NP_001246454.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001013881.1 Gene:Inpp5k / 287533 RGDID:1359130 Length:446 Species:Rattus norvegicus


Alignment Length:303 Identity:94/303 - (31%)
Similarity:143/303 - (47%) Gaps:36/303 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   578 LVDVNNPSENVDHPVDIYAIGFEE----IVDLNASNIMAASTDNAKLWAEELQKTISRDNDYVLL 638
            |:.:||...|    :|||.||.:|    |:.|.:.   ||..|.   |:......:|..| .|.:
  Rat    38 LLQLNNEDLN----LDIYIIGLQEMNYGIISLLSD---AAFEDP---WSSFFMDMLSPLN-LVKI 91

  Fly   639 TYQQLVGVCLYIYIRPEHAPHIRDVAIDCVKTGLGGATGNKGACAIRFVLHGTSMCFVCAHFAAG 703
            :..::.|:.|.::.:.:|.|:|:.::...:.|||.|..||||...|...|:|..:..|..|....
  Rat    92 SQVRMQGLLLLVFAKYQHLPYIQIISTKSIPTGLYGYWGNKGGINICLKLYGYYVSIVNCHLPPH 156

  Fly   704 QSQVAERNADYAEITRKLAF-----PMGRTLKSHDWVFWCGDFNYRI-DMEKDELKECVRNGDLS 762
            .....:|...:..|...|.|     |   .:..||.:.|.||.|:|| |.....::||:......
  Rat   157 MYNNDQRLEHFDRILESLTFEGYDVP---NILDHDLILWFGDMNFRIEDFGLLFVQECITKKRYK 218

  Fly   763 TVLEFDQLRKEQEAGNVFGEFLEGEITFDPTYKYDLFSDDYDTSEKQRAPAWTDRVLWRRRKALA 827
            .:.|.|||...::...:..||.||.:.|.||||:|..|::||||||:|.||||||:|||.::..|
  Rat   219 ELWEKDQLFIAKKQDQLLREFQEGPLLFPPTYKFDRHSNNYDTSEKKRKPAWTDRILWRLKRQPA 283

  Fly   828 EGDFAASAWNPGKLI-----HYGRSELKQSDHRPVIAIIDAEI 865
            :.       ||...:     :........|||:||....|.|:
  Rat   284 KA-------NPSGFLLTQKDYVSHMTYSISDHKPVTGTFDLEL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SynjNP_001246454.1 Syja_N 61..353 CDD:280532
INPP5c_Synj 538..863 CDD:197323 92/299 (31%)
DUF1866 862..1008 CDD:286093 2/4 (50%)
Inpp5kNP_001013881.1 EEP 17..317 CDD:294334 92/299 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.