DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synj and Sh2d1b1

DIOPT Version :10

Sequence 1:NP_569729.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_036139.3 Gene:Sh2d1b1 / 26904 MGIID:1349420 Length:132 Species:Mus musculus


Alignment Length:76 Identity:16/76 - (21%)
Similarity:29/76 - (38%) Gaps:18/76 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 HAPTTVLRELCKRYTEYVRPRMARVAVGTYNVNGGKHFRSIVFKDSLADWLLDCHALARSKALVD 580
            |.|.|:...|.:..::|.:|....|.          |..:.:.:::|      |....|.:..::
Mouse    70 HTPRTIFPNLQELVSKYGKPGQGLVV----------HLSNPIMRNNL------CQRGRRMELELN 118

  Fly   581 V--NNPSENVD 589
            |  |...|.||
Mouse   119 VYENTDKEYVD 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SynjNP_569729.1 COG5329 61..493 CDD:227637
INPP5c_Synj 538..863 CDD:197323 10/54 (19%)
DUF1866 862..1008 CDD:286093
Sh2d1b1NP_036139.3 SH2_SAP1 1..103 CDD:198205 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.