DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Synj and si:ch73-264p11.1

DIOPT Version :9

Sequence 1:NP_001246454.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_001189421.1 Gene:si:ch73-264p11.1 / 100000923 ZFINID:ZDB-GENE-120703-35 Length:143 Species:Danio rerio


Alignment Length:30 Identity:10/30 - (33%)
Similarity:16/30 - (53%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 EELQKTISRDNDYVLLTYQQLVG-VCLYIY 651
            |||.....||..|::...:.:.| :||.:|
Zfish    16 EELLGNKGRDGTYLIRDSETIQGAMCLCVY 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SynjNP_001246454.1 Syja_N 61..353 CDD:280532
INPP5c_Synj 538..863 CDD:197323 10/30 (33%)
DUF1866 862..1008 CDD:286093
si:ch73-264p11.1NP_001189421.1 SH2 4..103 CDD:301589 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.