powered by:
Protein Alignment Synj and si:ch73-264p11.1
DIOPT Version :9
Sequence 1: | NP_001246454.1 |
Gene: | Synj / 37517 |
FlyBaseID: | FBgn0034691 |
Length: | 1218 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189421.1 |
Gene: | si:ch73-264p11.1 / 100000923 |
ZFINID: | ZDB-GENE-120703-35 |
Length: | 143 |
Species: | Danio rerio |
Alignment Length: | 30 |
Identity: | 10/30 - (33%) |
Similarity: | 16/30 - (53%) |
Gaps: | 1/30 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 623 EELQKTISRDNDYVLLTYQQLVG-VCLYIY 651
|||.....||..|::...:.:.| :||.:|
Zfish 16 EELLGNKGRDGTYLIRDSETIQGAMCLCVY 45
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170579682 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5411 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.