DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcT and OMR1

DIOPT Version :9

Sequence 1:NP_611636.1 Gene:GlcT / 37516 FlyBaseID:FBgn0067102 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_187616.1 Gene:OMR1 / 820166 AraportID:AT3G10050 Length:592 Species:Arabidopsis thaliana


Alignment Length:281 Identity:55/281 - (19%)
Similarity:86/281 - (30%) Gaps:114/281 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 ADVLGINCHTGMSCLLRKAVIDQLGGLRAFGCYL----AEDFFIARS-------VTRLGWKMRIS 254
            |:.:.::.|.|     .:.::||:||. |.|..:    .|.|.|:|:       |||        
plant   297 ANAMALSLHHG-----ERVILDQVGGF-ADGVAVKEVGEETFRISRNLMDGVVLVTR-------- 347

  Fly   255 NQPALQNSGLCDIGSFQARLIRWAKLRVAMVPTTILLEPLSECMILGAIAAWSASVLFSWDPLVF 319
                   ..:|            |.::........:|||.....:.||.|               
plant   348 -------DAIC------------ASIKDMFEEKRNILEPAGALALAGAEA--------------- 378

  Fly   320 YLVHVLCWF--LSDWLLLSIVQHGSMPFHKF-------------EFVVGWLFRELTGPYLFLHAL 369
                 .|.:  |.|..:::|....:|.|.|.             |.|:..|..|..|.:.....|
plant   379 -----YCKYYGLKDVNVVAITSGANMNFDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCEL 438

  Fly   370 WNP----AIRWRARTYK----LHWGGV--AYELNSL---------------ASDAANDPLAPQPQ 409
            ..|    ..::|..:.|    |:..||  |.||.:|               .||...|       
plant   439 VGPMNISEFKYRCSSEKEAVVLYSVGVHTAGELKALQKRMESSQLKTVNLTTSDLVKD------- 496

  Fly   410 PAPTLEPAVVNAGTTGDTLIC 430
               .|...:....|.||.::|
plant   497 ---HLRYLMGGRSTVGDEVLC 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcTNP_611636.1 BcsA 4..399 CDD:224136 48/248 (19%)
Glucosylceramide_synthase 52..281 CDD:133012 18/90 (20%)
OMR1NP_187616.1 PLN02550 1..592 CDD:178165 55/281 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.