powered by:
Protein Alignment GlcT and SRR
DIOPT Version :9
Sequence 1: | NP_611636.1 |
Gene: | GlcT / 37516 |
FlyBaseID: | FBgn0067102 |
Length: | 440 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_068766.1 |
Gene: | SRR / 63826 |
HGNCID: | 14398 |
Length: | 340 |
Species: | Homo sapiens |
Alignment Length: | 52 |
Identity: | 14/52 - (26%) |
Similarity: | 25/52 - (48%) |
Gaps: | 8/52 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 VEDKEDPAI-----QLVERLLAKYPLVDAALF-VGGSDV--GVNPKINNIHP 131
|...::||: .:...:|.:.|||||.:. |||..: |:...:..:.|
Human 151 VHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKP 202
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1171 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.