DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcT and Srr

DIOPT Version :9

Sequence 1:NP_611636.1 Gene:GlcT / 37516 FlyBaseID:FBgn0067102 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001156783.1 Gene:Srr / 27364 MGIID:1351636 Length:339 Species:Mus musculus


Alignment Length:52 Identity:15/52 - (28%)
Similarity:25/52 - (48%) Gaps:8/52 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VEDKEDPAI-----QLVERLLAKYPLVDAALF-VGGSDV--GVNPKINNIHP 131
            |...::||:     .:...:|.:.|||||.:. |||..:  |:...|..:.|
Mouse   151 VHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMVAGIAITIKALKP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcTNP_611636.1 BcsA 4..399 CDD:224136 15/52 (29%)
Glucosylceramide_synthase 52..281 CDD:133012 15/52 (29%)
SrrNP_001156783.1 Trp-synth-beta_II 5..322 CDD:294246 15/52 (29%)
Substrate binding. /evidence=ECO:0000250 238..239
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.