DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcT and Sds

DIOPT Version :9

Sequence 1:NP_611636.1 Gene:GlcT / 37516 FlyBaseID:FBgn0067102 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_006530361.1 Gene:Sds / 231691 MGIID:98270 Length:352 Species:Mus musculus


Alignment Length:128 Identity:30/128 - (23%)
Similarity:55/128 - (42%) Gaps:31/128 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VHVIAI-CYGRYKLHK--KSCKLPTEAQPLPGVSILKPLMGVDPNLQHNLETFFTMDYPLYELLF 86
            |.:||: .:|.:..|.  |..||.|    ||.::.:...:||:......|:.|:  ::|::..: 
Mouse   213 VPIIAMETFGAHSFHAAIKEGKLVT----LPKITSVAKALGVNTVGAQTLKLFY--EHPIFSEV- 270

  Fly    87 CVEDKEDPAIQLVERLLAKYPLVDAALFVGGSDVGVNPKINNIHPGYMAAKYDFVM--ISDSG 147
             :.|:|  |:..:|:            ||....:.|.|...    ..:||.|..|:  :.|.|
Mouse   271 -ISDQE--AVSALEK------------FVDDEKILVEPACG----AALAAVYSRVVCRLQDEG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcTNP_611636.1 BcsA 4..399 CDD:224136 30/128 (23%)
Glucosylceramide_synthase 52..281 CDD:133012 20/98 (20%)
SdsXP_006530361.1 L-Ser-dehyd 35..345 CDD:107209 30/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.