DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcT and Y51H7C.9

DIOPT Version :10

Sequence 1:NP_611636.1 Gene:GlcT / 37516 FlyBaseID:FBgn0067102 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_493968.1 Gene:Y51H7C.9 / 173519 WormBaseID:WBGene00021787 Length:448 Species:Caenorhabditis elegans


Alignment Length:102 Identity:23/102 - (22%)
Similarity:31/102 - (30%) Gaps:46/102 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SCLLRKAVIDQLGGLRAFGCYLAEDFF------------------------IARSVTR------- 246
            |.||||::...|...|.......:|.|                        |.|:..|       
 Worm     4 STLLRKSIFYSLAHRRHVASVPLKDVFCDPENPKILQFGDISMAHHRIQNGIVRTDCRKSRCLSK 68

  Fly   247 -----LGWKMRISNQPALQNSGLCDIGSFQARLIRWA 278
                 :..||.: ||         |.|||:.|..|:|
 Worm    69 LFDMNIYLKMEV-NQ---------DTGSFKERGARYA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcTNP_611636.1 Glucosylceramide_synthase 52..281 CDD:133012 23/102 (23%)
Y51H7C.9NP_493968.1 Thr-dehyd 41..345 CDD:107205 14/65 (22%)
ACT_ThrD-II-like 366..431 CDD:153158
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.