powered by:
Protein Alignment GlcT and Y51H7C.9
DIOPT Version :9
Sequence 1: | NP_611636.1 |
Gene: | GlcT / 37516 |
FlyBaseID: | FBgn0067102 |
Length: | 440 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493968.1 |
Gene: | Y51H7C.9 / 173519 |
WormBaseID: | WBGene00021787 |
Length: | 448 |
Species: | Caenorhabditis elegans |
Alignment Length: | 102 |
Identity: | 23/102 - (22%) |
Similarity: | 31/102 - (30%) |
Gaps: | 46/102 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 SCLLRKAVIDQLGGLRAFGCYLAEDFF------------------------IARSVTR------- 246
|.||||::...|...|.......:|.| |.|:..|
Worm 4 STLLRKSIFYSLAHRRHVASVPLKDVFCDPENPKILQFGDISMAHHRIQNGIVRTDCRKSRCLSK 68
Fly 247 -----LGWKMRISNQPALQNSGLCDIGSFQARLIRWA 278
:..||.: || |.|||:.|..|:|
Worm 69 LFDMNIYLKMEV-NQ---------DTGSFKERGARYA 95
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1171 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.