DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcT and srr

DIOPT Version :9

Sequence 1:NP_611636.1 Gene:GlcT / 37516 FlyBaseID:FBgn0067102 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_002661511.2 Gene:srr / 100331498 ZFINID:ZDB-GENE-110914-210 Length:323 Species:Danio rerio


Alignment Length:233 Identity:44/233 - (18%)
Similarity:75/233 - (32%) Gaps:94/233 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HVIAICYGRY-KLHKKSCK---------LPTEAQPLP--------GVSILK----PLMGV----- 63
            |.:.:..|.| |....:||         :| |..|:.        ||.:.:    .||||     
Zfish    79 HFVTMSAGNYGKAFSYACKHYGSKGKVVMP-ETAPISRSVLIQNLGVEVERVPTTQLMGVVNRCV 142

  Fly    64 ------------DPNL--QHNLETFFTMD---YPLYELLFC-----------------VED---- 90
                        ||:|  .|:...|..:|   ||...::.|                 .||    
Zfish   143 QEDGMTFLHSIDDPDLIAGHSSLGFEILDVVPYPDVVVVCCGGGGLLSGVAAAIKLSGCEDTKIY 207

  Fly    91 --KEDPAIQLVERLLAKYPL-VDAALFVGGSDVGVNPKINNIHPGYMAAKY--DFVMISDSGIKM 150
              :.:.|..:.:..:.|.|: :||.....    |:.|....:....:..:|  ..|::||..||.
Zfish   208 GVEPEGACTMYKSFIEKRPVGMDAKSIAS----GLAPPFAGMLAYQLCQRYVEKIVLVSDEEIKS 268

  Fly   151 KDDTLL-------------------DMVQNMSEKHALV 169
            ...||.                   |.:.::.:|:.:|
Zfish   269 AVSTLYKAGLVVEPSGTAAFTAIINDKIPDIQDKNVVV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcTNP_611636.1 BcsA 4..399 CDD:224136 44/233 (19%)
Glucosylceramide_synthase 52..281 CDD:133012 35/197 (18%)
srrXP_002661511.2 PALP 26..310 CDD:278708 44/233 (19%)
Trp-synth-beta_II 28..313 CDD:294246 44/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.