DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13501 and rsph14

DIOPT Version :9

Sequence 1:NP_611631.1 Gene:CG13501 / 37510 FlyBaseID:FBgn0034684 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001314795.1 Gene:rsph14 / 553388 ZFINID:ZDB-GENE-081104-375 Length:340 Species:Danio rerio


Alignment Length:160 Identity:43/160 - (26%)
Similarity:74/160 - (46%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RAELAYGWFALPKLLKELDSDVRLTHWKAVVSLSEFVLNPLNAQRAIIE--MDLVRKL---KNAF 120
            :|.:|:|..||||||.||..|...|..||:.:|.:.:.:|..|..||..  :::::.|   :::.
Zfish    18 QAPIAFGNLALPKLLVELQDDDLFTRQKALTALCDLLHDPERAYEAIFSECLEILKVLLQDEDSL 82

  Fly   121 MRMR-------LKHHKEEHREVEMYLRIYNILSRNLDGAENIANRKCLR------VEF-----YK 167
            :|::       |..| ...|:..:...|...|:..||..| ||.||.:.      .||     :.
Zfish    83 IRVKTTEVLYVLASH-SMGRDAFLNFDIVGPLANLLDDPE-IACRKNVHRALNRIAEFPLGAVFM 145

  Fly   168 IIKNQEP-------IKDE-LASEILRNLTC 189
            :.|...|       |::| :.:.:|..|:|
Zfish   146 VNKGLVPRLVPKISIEEENIRALVLSTLSC 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13501NP_611631.1 None
rsph14NP_001314795.1 ARM 27..137 CDD:304564 31/111 (28%)
HEAT repeat 27..55 CDD:293787 13/27 (48%)
HEAT repeat 69..93 CDD:293787 2/23 (9%)
HEAT repeat 113..134 CDD:293787 8/21 (38%)
HEAT repeat 151..175 CDD:293787 5/23 (22%)
ARM 186..299 CDD:237987
HEAT repeat 189..217 CDD:293787
HEAT repeat 229..262 CDD:293787
ARM 268..>340 CDD:304564
HEAT repeat 271..296 CDD:293787
HEAT repeat 307..336 CDD:293787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.