DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13501 and Rsph14

DIOPT Version :9

Sequence 1:NP_611631.1 Gene:CG13501 / 37510 FlyBaseID:FBgn0034684 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_006256402.1 Gene:Rsph14 / 365552 RGDID:1305601 Length:341 Species:Rattus norvegicus


Alignment Length:353 Identity:87/353 - (24%)
Similarity:134/353 - (37%) Gaps:118/353 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RAELAYGWFALPKLLKELDSDVRLTHWKAVVSLSEFVLNP-----------LNAQRAIIEMD--L 112
            :|.:|||..||.||.:||.|:..||..|||::|.:.:.:|           |.:.:|:::.|  |
  Rat    18 KAAIAYGCRALRKLNEELQSEDLLTRQKAVMALCDLMHDPEYVYEAINIGCLESLKALLKDDDNL 82

  Fly   113 VR-KLKNAFMRMR---------LKHH--------KEEHREV--EMYLRIYNILSRNLDGAENIAN 157
            || |.......|.         |||.        ..:|:.:  |...:.|..|::..:||:.|..
  Rat    83 VRIKTTEVLYIMATHNVGRVGFLKHDIILALSRLLSDHQTLCRENLHQAYKHLAQLPEGAQGIVT 147

  Fly   158 RKCLRVEFYKIIKN----QEPIKDEL-------ASEILRN--LTC-KPKVLGIFLEDPENFS--- 205
            ...:.....|:.|.    ||.|.|.|       |:|.|.:  :.| |.|   :|..:|:..|   
  Rat   148 SGLISFLVRKLQKEELHIQEIILDTLALCLQEDATEALNSQAVPCFKEK---LFSGNPQIRSKAA 209

  Fly   206 -ALAEIFRQDPCRPQFPL----HLWHHLCDMLEVAPDRGIELGLFELLHSRILNRLSNFWDMNTK 265
             ||..|        ..||    .:|.:     ||.|               ||..|.:..|...|
  Rat   210 RALIAI--------SIPLDGKRQVWQN-----EVIP---------------ILVDLLSDTDEEVK 246

  Fly   266 ---AFALLLCCAEGQRRFDAVDG------VKLLYDV---------------FAQPDENPRMLLPR 306
               |.||:......:.::.|:|.      ::||..:               .|:..|..::||||
  Rat   247 ANAAGALMHATVTTEGKYAALDANAIDPLLELLCSIPTTKVCLNATKALTMLAEAPEGRKLLLPR 311

  Fly   307 QKVENWEYTALALLNGLHSKRALWRSRE 334
              |..:.|    ||.  |...|:.|:.|
  Rat   312 --VPTFRY----LLT--HKNEAIRRAAE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13501NP_611631.1 None
Rsph14XP_006256402.1 HEAT repeat 27..55 CDD:293787 13/27 (48%)
HEAT repeat 72..93 CDD:293787 6/20 (30%)
HEAT repeat 109..137 CDD:293787 4/27 (15%)
ARM 143..253 CDD:237987 32/140 (23%)
HEAT repeat 151..175 CDD:293787 7/23 (30%)
armadillo repeat 190..215 CDD:293788 8/27 (30%)
armadillo repeat 222..257 CDD:293788 12/54 (22%)
ARM 224..337 CDD:237987 30/136 (22%)
armadillo repeat 263..295 CDD:293788 4/31 (13%)
HEAT repeat 308..334 CDD:293787 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15599
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.