DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13501 and RSPH14

DIOPT Version :9

Sequence 1:NP_611631.1 Gene:CG13501 / 37510 FlyBaseID:FBgn0034684 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_011528452.1 Gene:RSPH14 / 27156 HGNCID:13437 Length:402 Species:Homo sapiens


Alignment Length:266 Identity:54/266 - (20%)
Similarity:108/266 - (40%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MPLCCNSTSTHLADRAELAYGWFALPKLLKELDSDVRLTHWKAVVSLSEFVLNPLNAQRAI---- 107
            :|:..|:|      :...|||..|||||.:||.|:...|..||:::|.:.:.:|....:|:    
Human    10 LPININAT------QITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGC 68

  Fly   108 IEMDLVRKLKNAFMRMRLK-----HHKEEHREVEMYLRIYNILSRNLDGAENIANRKCLRVEFYK 167
            :| :|...||::...:|:|     |....| .|..|..:.:.:...|....|..:..| |...||
Human    69 ME-NLKALLKDSNSMVRIKTTEVLHITASH-SVGRYAFLEHDIVLALSFLLNDPSPVC-RGNLYK 130

  Fly   168 ----IIKNQEPIKDELASEILRNLTCKPKVLGIFLEDPENFSALAEIFRQDPCRPQFPLHLWHHL 228
                :::.....::.::..::.:|..|   |.:.:|:.|                 |...:...|
Human   131 AYMQLVQVPRGAQEIISKGLISSLVWK---LQVEVEEEE-----------------FQEFILDTL 175

  Fly   229 CDMLEVAPDRGIELGLFELLHSRILNRLSNFWDMNTKAFALLLCCAEGQRRFDAVDGVKLLYDVF 293
            ...|:......:...:..:|..::|:...|......:|...:....||:::....|.:.:|..:.
Human   176 VLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKAARALLNVSISREGKKQVCHFDVIPILVHLL 240

  Fly   294 AQPDEN 299
            ..|.|:
Human   241 KDPVEH 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13501NP_611631.1 None
RSPH14XP_011528452.1 ARM <18..91 CDD:237987 23/73 (32%)
HEAT repeat 27..55 CDD:293787 12/27 (44%)
HEAT_2 28..131 CDD:290374 28/105 (27%)
HEAT repeat 65..97 CDD:293787 7/32 (22%)
HEAT repeat 107..134 CDD:293787 6/27 (22%)
ARM 188..>255 CDD:237987 10/59 (17%)
HEAT_2 194..>255 CDD:290374 10/53 (19%)
armadillo repeat 224..256 CDD:293788 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.