DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and ERP3

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_010266.1 Gene:ERP3 / 851544 SGDID:S000002176 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:43/202 - (21%)
Similarity:83/202 - (41%) Gaps:31/202 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFK--DVGVEIAGPDDDR--LHHSKQDTMGS 76
            |.:.:|.:...|:.:|            |.|.:|...  ||..||..|||..  :.....:..|.
Yeast    35 CLYTLTPEIDCTISYY------------FAVQQGESNDFDVNYEIFAPDDKNKPIIERSGERQGE 87

  Fly    77 FTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSK-----------RVDDVIEQA 130
            ::|....:|.|.:||....:......|.|:::..|..:...:..|           :.|.:  |.
Yeast    88 WSFIGQHKGEYAICFYGGKAHDKIVDLDFKYNCERQDDIRNERRKARKAQRNLRDSKTDPL--QD 150

  Fly   131 TVQSMINQLSAKLGAVKMEQEYMHFR-YRGHLEVSDMVELRVLAWSIFGPMMLIITAVLEVYYLK 194
            :|::.|:.:..:|..::...:|...| .|.|..|.. .|.|::.:||:|.:::|..:..::..|:
Yeast   151 SVENSIDTIERQLHVLERNIQYYKSRNTRNHHTVCS-TEHRIVMFSIYGILLIIGMSCAQIAILE 214

  Fly   195 HFFEVKR 201
            ..|...|
Yeast   215 FIFRESR 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 40/196 (20%)
ERP3NP_010266.1 EMP24_GP25L 23..218 CDD:395878 41/197 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53803
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.