DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and ERP2

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_009395.1 Gene:ERP2 / 851226 SGDID:S000000005 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:44/203 - (21%)
Similarity:79/203 - (38%) Gaps:35/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVLVLFQAACG------FIVTLDAHETMC-FYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPD 62
            |||:|.|..:...      ..::|.|....| :||.....|.:.|.::|:.||..::..:|..||
Yeast    13 IVLILALVNSVAASSSYAPVAISLPAFSKECLYYDMVTEDDSLAVGYQVLTGGNFEIDFDITAPD 77

  Fly    63 DDRLHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRV---- 123
            ...:...||.....|...:...|:|..||.|...|...|           :|..::..|.:    
Yeast    78 GSVITSEKQKKYSDFLLKSFGVGKYTFCFSNNYGTALKK-----------VEITLEKEKTLTDEH 131

  Fly   124 ------DDVIEQATVQSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAWSIFGPMML 182
                  ||:|    ..:.:.::...|..:.....|:..|...::...:..|.|:...||   :::
Yeast   132 EADVNNDDII----ANNAVEEIDRNLNKITKTLNYLRAREWRNMSTVNSTESRLTWLSI---LII 189

  Fly   183 IITAVLEV 190
            ||.||:.:
Yeast   190 IIIAVISI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 39/191 (20%)
ERP2NP_009395.1 EMP24_GP25L 34..183 CDD:395878 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53803
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.