DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and AT3G22845

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_188924.3 Gene:AT3G22845 / 821856 AraportID:AT3G22845 Length:214 Species:Arabidopsis thaliana


Alignment Length:190 Identity:48/190 - (25%)
Similarity:79/190 - (41%) Gaps:28/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLFQ--AACGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDRLHHSKQD 72
            ||::  ...|..|.:| |:.....||..:...||                  .|..:.:...|..
plant    42 VLYEGDTVSGNFVVVD-HDIFWGSDHPGLDFTVT------------------SPAGNIVQTLKGT 87

  Fly    73 TMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVIEQATVQSMIN 137
            :...|.|.|.|.|.|:.||.|..|  ||:.:.|..||.. |....|.:|  |:.::...|:  |.
plant    88 SGDKFEFKAPKSGMYKFCFHNPYS--TPETVSFYIHVGH-IPNEHDLAK--DEHLDPVNVK--IA 145

  Fly   138 QLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAWSIFGPMMLIITAVLEVYYLKHFF 197
            :|...|.:|..||:|:..|...|...::....||:.:::...:.|...:.|:|.|::..|
plant   146 ELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVGEYIFLAAASGLQVLYIRKLF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 46/181 (25%)
AT3G22845NP_188924.3 EMP24_GP25L 33..205 CDD:395878 47/188 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2948
eggNOG 1 0.900 - - E1_KOG1692
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2316
OMA 1 1.010 - - QHG53803
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm1213
orthoMCL 1 0.900 - - OOG6_101558
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.