DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and tmed2

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_012820011.1 Gene:tmed2 / 734103 XenbaseID:XB-GENE-986353 Length:208 Species:Xenopus tropicalis


Alignment Length:205 Identity:84/205 - (40%)
Similarity:125/205 - (60%) Gaps:3/205 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSAIVLVLVLFQA-ACGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDR 65
            ||.:|.:|..|.| |.|:.|::|||...||::......|:.:.|||.||||.|:.|||.|||:..
 Frog     4 LSELVALLCFFSATASGYFVSIDAHAEECFFEQVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKG 68

  Fly    66 LHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDV--IE 128
            :|...:::.|.:||.|..:|.|:.||.|:||||||||:||...:..|.:.....::.:.:.  ..
 Frog    69 IHKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEGIGESWDAH 133

  Fly   129 QATVQSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAWSIFGPMMLIITAVLEVYYL 193
            |..::.|||:|:..:.|||.|||||..|.|.|..::|....||:.||.|..::|:...:.::|||
 Frog   134 QNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYL 198

  Fly   194 KHFFEVKRVV 203
            |.||||:|||
 Frog   199 KRFFEVRRVV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 71/182 (39%)
tmed2XP_012820011.1 EMP24_GP25L 23..203 CDD:366467 70/179 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53803
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.