DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and Tmed2

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001380734.1 Gene:Tmed2 / 65165 RGDID:69243 Length:208 Species:Rattus norvegicus


Alignment Length:208 Identity:83/208 - (39%)
Similarity:120/208 - (57%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVLVLFQAACGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDRLHHS 69
            :||:..|...|.|:.|::|||...||::......|:.:.|||.||||.|:.|||.|||:..::..
  Rat     8 LVLLAALLATASGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKG 72

  Fly    70 KQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVIE------ 128
            .:::.|.:||.|..:|.|:.||.|:||||||||:||...:..|       .|..|...|      
  Rat    73 DRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEA-------PKGQDMETEGGGDSW 130

  Fly   129 ---QATVQSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAWSIFGPMMLIITAVLEV 190
               |..::.|||:|:..:.|||.|||||..|.|.|..::|....||:.||.|..::|:...:.::
  Rat   131 DAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQI 195

  Fly   191 YYLKHFFEVKRVV 203
            ||||.||||:|||
  Rat   196 YYLKRFFEVRRVV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 73/189 (39%)
Tmed2NP_001380734.1 EMP24_GP25L 23..203 CDD:395878 72/186 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53803
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101558
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.