DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and tmed7

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_989261.1 Gene:tmed7 / 394874 XenbaseID:XB-GENE-5847420 Length:219 Species:Xenopus tropicalis


Alignment Length:204 Identity:62/204 - (30%)
Similarity:92/204 - (45%) Gaps:18/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLVLFQAAC----GFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDRLH 67
            |..|||...|    .....|..:...|||:......|.|:.|:|:.||..||...:..||...|:
 Frog    17 LSFVLFSLGCVRASELTFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGIVLY 81

  Fly    68 HSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVIEQATV 132
            ...:....||||||.:.|.|:.||.|:.||.|.|.:.|.|.|......:.:.::        ||.
 Frog    82 KEMKKQYDSFTFTATRNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNENR--------ATA 138

  Fly   133 QSMINQLSAKL-GAVKMEQEYM-HFRYR---GHLEVSDMVELRVLAWSIFGPMMLIITAVLEVYY 192
            .:.:......: .|:|...:|. |||.|   |.....|: ..||..|||...::|::.::.:|:.
 Frog   139 LTQMESSCVSIHEALKSVIDYQTHFRLREAQGRSRAEDL-NSRVAYWSIGEAIILLVVSIGQVFL 202

  Fly   193 LKHFFEVKR 201
            ||.||..||
 Frog   203 LKSFFSDKR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 54/185 (29%)
tmed7NP_989261.1 EMP24_GP25L 31..208 CDD:366467 54/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.