DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and tmed5

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_956697.1 Gene:tmed5 / 393374 ZFINID:ZDB-GENE-040426-1302 Length:225 Species:Danio rerio


Alignment Length:193 Identity:46/193 - (23%)
Similarity:89/193 - (46%) Gaps:15/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDRLHHSKQDTMGSFTFTAM 82
            |..||.|....||:........:.:.::|::|...||..::..|....:....:.:.|..| ...
Zfish    33 FTFTLAAGRRECFFQTMKKDASLEIEYQVLDGASLDVDFQLNSPSGHIIASDYRKSDGVHT-VET 96

  Fly    83 KEGRYQLCFDNKMSTMTPKILMFQFHVARAIE--------FYMDSSKRVDDVIEQATVQSMINQL 139
            :||.|..||||..|.::.|::.|:..:....|        .|:..:..:|..:|.  :...||.:
Zfish    97 EEGDYMFCFDNTFSAVSEKVIFFELILDNMGEDEESEDWKAYVQGADLLDMKLED--IMDTINNV 159

  Fly   140 SAKLG-AVKMEQEYMHFRYRG-HLEVSDMVELRVLAWSIFGPMMLIITAVLEVYYLKHFFEVK 200
            .::|| :::::.....|..|. :|:.|:..  ||..||....::::|.:.::||.|:..||.|
Zfish   160 KSRLGKSLQIQTLLRAFEARDRNLQESNYE--RVNLWSCTNVLVMVIVSGVQVYLLRSLFEDK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 43/189 (23%)
tmed5NP_956697.1 EMP24_GP25L 32..218 CDD:279450 43/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.