DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and loj

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster


Alignment Length:193 Identity:43/193 - (22%)
Similarity:85/193 - (44%) Gaps:14/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ACGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDRLHHSKQDTMGSFTF 79
            |..:.|.:||.:..|::.:........|||.|:.||....|..:..|..:.:...:......:|.
  Fly    45 AMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGGDGMAGFAVRNPAGEVVKPYQWQATADYTD 109

  Fly    80 TAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVIEQATVQSMINQLSAKLG 144
            .....|.|.:|.||:.|....|::.....|.:     .|:..:....|||  :|..:...:|.:|
  Fly   110 QVSPGGYYSVCIDNQFSRFAGKLVNIYITVVK-----YDAWDKYAKEIEQ--LQLNMQNFTATVG 167

  Fly   145 AVKMEQEYM-----HFRYRGHLEVSDMVE--LRVLAWSIFGPMMLIITAVLEVYYLKHFFEVK 200
            .|:.....|     |.|:|...:.:.:::  ..:..:||...::::||..::|::::..||||
  Fly   168 TVERNINDMMGYQAHSRHRESRDYALLLDNNAYIQTFSISQIVVILITCSVQVFFVRKLFEVK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 38/187 (20%)
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 38/187 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.