powered by:
Protein Alignment CG9308 and Ticam2
DIOPT Version :9
Sequence 1: | NP_611629.1 |
Gene: | CG9308 / 37507 |
FlyBaseID: | FBgn0034681 |
Length: | 203 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102360.1 |
Gene: | Ticam2 / 364867 |
RGDID: | 1308258 |
Length: | 232 |
Species: | Rattus norvegicus |
Alignment Length: | 64 |
Identity: | 16/64 - (25%) |
Similarity: | 28/64 - (43%) |
Gaps: | 13/64 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 DDVIEQATVQSMI-NQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVE-LRVLAWSIFGPMMLIIT 185
||..|...||::: |....:.|.|..|... |.|.:.::.: :...||:| |::|
Rat 85 DDTNEALRVQNLLQNDFGIRPGIVFAEMPC------GRLHLQNLDDAVNGSAWTI-----LLLT 137
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166344437 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.