DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and CG31787

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster


Alignment Length:196 Identity:40/196 - (20%)
Similarity:77/196 - (39%) Gaps:27/196 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDR---LHHSKQDTMGSFTFTA 81
            |..:|....|||.....::.:.:.::|:.||..:..:.....|..|   :..:|:. ||..:..|
  Fly    33 VFAEAGRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMDPSRRLLIAETKRQ-MGKHSIQA 96

  Fly    82 MKEGRYQLCFDNKMSTMTPKILMFQFHVARA---------------IEFYMDSSKRVDDVIEQAT 131
            .:.|.|:.||||.:||...||:.|...||.|               .:::.|        :....
  Fly    97 NETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQEMLTDYHFD--------VAYTG 153

  Fly   132 VQSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAWSIFGPMMLIITAVLEVYYLKHF 196
            :.|.:.::...|...:..|:::.........|::.....|..||....:.:|....|:|..::..
  Fly   154 IDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSI 218

  Fly   197 F 197
            |
  Fly   219 F 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 40/196 (20%)
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 40/196 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.