DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and Tmed1

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_006242706.1 Gene:Tmed1 / 315461 RGDID:1311679 Length:262 Species:Rattus norvegicus


Alignment Length:261 Identity:64/261 - (24%)
Similarity:89/261 - (34%) Gaps:72/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SAIVLVLVLFQAACG-------------FIVTLDAHETMCFYDH--ANVS---------DKVTVS 43
            :|:.|.|.|...|.|             |...|.|....|||..  ||.|         .:|.|.
  Rat     6 AAVALALWLLLPAVGVGEAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQFDNSRVEVE 70

  Fly    44 ------------------------FEVMEGGFKDVGVEIAGPDDDRLHHSKQDTMGSFTFTAMKE 84
                                    |.|:.|...||...:..|....|....:...|..|....:.
  Rat    71 NRLLQVALQSPQALLLYPKQRNGIFVVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEA 135

  Fly    85 GRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVIEQATVQSMINQLSAKLGAVKME 149
            |.|:|||||..||::.|::.|        |...||.:..::|...|........|..|:..:|..
  Rat   136 GDYRLCFDNSFSTISEKLVFF--------ELIFDSFQDEEEVEGWAEAVEPEEMLDVKMEDIKES 192

  Fly   150 QEYMHFRYRGHLEV---------------SDMVELRVLAWSIFGPMMLIITAVLEVYYLKHFFEV 199
            .|.|..|....:::               .|.:| ||..||.....:|::.|||:|..||.||..
  Rat   193 IETMRTRLERSIQMLTLLRAFEARDRNLQEDNLE-RVNFWSAANVAVLLLVAVLQVCTLKRFFHD 256

  Fly   200 K 200
            |
  Rat   257 K 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 57/243 (23%)
Tmed1XP_006242706.1 EMP24_GP25L 33..254 CDD:279450 55/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.