DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and CHOp24

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster


Alignment Length:211 Identity:83/211 - (39%)
Similarity:133/211 - (63%) Gaps:16/211 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSAIVL----VLVLFQAACGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPD 62
            |:.::|    :|:|.:.:..|||::|||...||:::.....|..|:|||::|||.||.::|:|||
  Fly     5 LAKVLLLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPD 69

  Fly    63 DDRLHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRV---- 123
            :..:|.|::::.|.:||.|..:|.|.:||:|:.|:||||::||...|.       |:.:|.    
  Fly    70 NHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVG-------DAPQRAPGAP 127

  Fly   124 -DDVIEQATVQSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAWSIFGPMMLIITAV 187
             ::.:....::.||.:||..|.:||.||||||.|.:.|..|::....||:.||.|..::|::..|
  Fly   128 GEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTV 192

  Fly   188 LEVYYLKHFFEVKRVV 203
            .:|||||.||||||||
  Fly   193 GQVYYLKRFFEVKRVV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 72/185 (39%)
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 72/185 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468924
Domainoid 1 1.000 81 1.000 Domainoid score I2948
eggNOG 1 0.900 - - E1_KOG1692
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2316
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm1213
orthoMCL 1 0.900 - - OOG6_101558
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.