DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and Tmed3

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001004249.1 Gene:Tmed3 / 300888 RGDID:1303327 Length:221 Species:Rattus norvegicus


Alignment Length:212 Identity:53/212 - (25%)
Similarity:94/212 - (44%) Gaps:18/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSAIVLVLVL-FQAACGFIVTLDAHET--MCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPD 62
            ||..::|:|:| .:...|..:|.:..:.  .||::......|.::.::|:.||..||...:..|.
  Rat    13 MLMLLLLLLLLRAERLRGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPM 77

  Fly    63 DDRLHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVI 127
            .:.::...:....|||:....:|.|:.||.|:.||.:.|.:.|.|.|........|...||..:.
  Rat    78 GNIIYRETKKQYDSFTYKTEVKGVYRFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALT 142

  Fly   128 EQATVQSMINQLSAKLGAVK-MEQEYMHFRYRGHLEVSDM-----VELRVLAWSIFGPMMLIITA 186
            :..:....|::      |:| :.....|:|.|   |..|.     :..||..||:...:.|.:.:
  Rat   143 QMESACVTIHE------ALKTVIDSQTHYRLR---EAQDRARAEDLNSRVSYWSVGETIALFVVS 198

  Fly   187 VLEVYYLKHFFEVKRVV 203
            ..:|..||.||..||.:
  Rat   199 FSQVLLLKSFFTEKRPI 215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 45/188 (24%)
Tmed3NP_001004249.1 EMP24_GP25L 32..209 CDD:279450 43/185 (23%)
COPI vesicle coat-binding. /evidence=ECO:0000255 208..221 4/8 (50%)