DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and Tmed5

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001007620.1 Gene:Tmed5 / 289883 RGDID:1359437 Length:229 Species:Rattus norvegicus


Alignment Length:222 Identity:58/222 - (26%)
Similarity:107/222 - (48%) Gaps:28/222 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSAIVLVLVLFQAACGFIVTLDAHETM--------CFYDHANVSDKVTVSFEVMEGGFKDVGVE 57
            ||....|...|...|.||..:||:..|.        |||....:...:.:.::|::||..|:...
  Rat    11 MLLLSALPATLLSGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGGELDIDFH 75

  Fly    58 IAGPDDDRLHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQF---HVARAIEFYMDS 119
            :|.|:...|...::.:.|..| ...::|.|..||||..||::.|::.|:.   ::...:|...|.
  Rat    76 LASPEGRTLVFEQRKSDGVHT-VETEDGDYMFCFDNTFSTISEKVIFFELILDNMGEEVEGQEDW 139

  Fly   120 SK----------RVDDVIEQATVQSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAW 174
            .|          :::|::|  ::.|:.::|| |.|.::........|.| :::.|:..  ||..|
  Rat   140 KKYITNTDVLEMKLEDILE--SINSIKSRLS-KSGHIQTLLRAFEARDR-NIQESNFD--RVNFW 198

  Fly   175 SIFGPMMLIITAVLEVYYLKHFFEVKR 201
            |:...|::::.:.::||.||..||.||
  Rat   199 SVVNLMVMVVVSAIQVYTLKSLFEDKR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 49/201 (24%)
Tmed5NP_001007620.1 EMP24_GP25L 35..222 CDD:279450 45/193 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.