DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and TMED3

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_031390.1 Gene:TMED3 / 23423 HGNCID:28889 Length:217 Species:Homo sapiens


Alignment Length:212 Identity:55/212 - (25%)
Similarity:97/212 - (45%) Gaps:20/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SAIVLVLVLFQAA---CGFIVTLDAHET--MCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPD 62
            ::::|:|:|.:.|   ||..:|.:..:.  .||::......|.::.::|:.||..||...:..|.
Human     9 ASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQ 73

  Fly    63 DDRLHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVI 127
            .:.::...:....|||:.|..:|.||.||.|:.||.:.|.:.|.|.|........|...||..:.
Human    74 GNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALT 138

  Fly   128 EQATVQSMINQLSAKLGAVK-MEQEYMHFRYRGHLEVSDM-----VELRVLAWSIFGPMMLIITA 186
            :..:....|::      |:| :.....|:|.|   |..|.     :..||..||:...:.|.:.:
Human   139 QMESACVTIHE------ALKTVIDSQTHYRLR---EAQDRARAEDLNSRVSYWSVGETIALFVVS 194

  Fly   187 VLEVYYLKHFFEVKRVV 203
            ..:|..||.||..||.:
Human   195 FSQVLLLKSFFTEKRPI 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 47/188 (25%)
TMED3NP_031390.1 EMP24_GP25L 28..205 CDD:307313 45/185 (24%)
COPI vesicle coat-binding. /evidence=ECO:0000255 204..217 4/8 (50%)