DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and Ticam2

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_036017008.1 Gene:Ticam2 / 225471 MGIID:3040056 Length:251 Species:Mus musculus


Alignment Length:64 Identity:16/64 - (25%)
Similarity:27/64 - (42%) Gaps:13/64 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DDVIEQATVQSMI-NQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVE-LRVLAWSIFGPMMLIIT 185
            ||..|...||.:: |....:.|.|..|...      |.|.:.::.: :...||:|     |::|
Mouse   104 DDTDEALRVQDLLQNDFGIRPGIVFAEMPC------GRLHLQNLDDAVNGSAWTI-----LLLT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 16/64 (25%)
Ticam2XP_036017008.1 TIR_2 97..>188 CDD:419986 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.