DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and tmed-1

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_502288.1 Gene:tmed-1 / 178145 WormBaseID:WBGene00010670 Length:234 Species:Caenorhabditis elegans


Alignment Length:228 Identity:54/228 - (23%)
Similarity:98/228 - (42%) Gaps:53/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLVLFQAACG---FIVTLDAHETMCFYDHANVSDKVT--VSFEVMEGGFKDVGVEIAGPDDDR 65
            |::|:.....||   |.|.:.|.:..||:...:::...|  |.::|::||..::...|       
 Worm    10 VILLITPFILCGEYDFTVEVPAGKFQCFFQPVDLAKHKTLEVDYQVIDGGDLNINFMI------- 67

  Fly    66 LHHS---KQDTM---GSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVD 124
            ||.:   |||.:   ||......:.|.||:||||..|..:.|::.|:.       |..|:...:|
 Worm    68 LHGANILKQDQLKVDGSHRIELNQPGDYQVCFDNSFSYQSRKVVFFEI-------FLFDAHGNLD 125

  Fly   125 DVIEQATVQSMI---NQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVEL----------------- 169
                :|.:.:|.   :.||||:..:.:..:..|.|..|.....:.||.                 
 Worm   126 ----EADLSAMARTDSDLSAKMNELGVTIDEFHRRANGIKNNLNKVEYHQALLRAHEARDRAVMS 186

  Fly   170 ----RVLAWSIFGPMMLIITAVLEVYYLKHFFE 198
                ||..||:...::::..|.::|:.::..||
 Worm   187 ANFDRVTFWSVVHTLVMVGVAGVQVFMIRSLFE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 49/215 (23%)
tmed-1NP_502288.1 EMP24_GP25L 24..219 CDD:366467 48/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.