DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and tmed-3

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_491892.1 Gene:tmed-3 / 172372 WormBaseID:WBGene00019003 Length:203 Species:Caenorhabditis elegans


Alignment Length:213 Identity:53/213 - (24%)
Similarity:89/213 - (41%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSAIVL--VLVLFQAACGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDD 63
            ||..:::  :||....:......|..:...|||:...........|:|:.||..||.:.|..|:.
 Worm     1 MLKFVIVSSILVALGLSIELTFELPDNANQCFYEDLKKDVDTVFEFQVVTGGHYDVDLIIEDPNG 65

  Fly    64 DRLHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVIE 128
            ..|:...:....|..|.|..||.|:.||.|:.||.:.||:            |||......:.:.
 Worm    66 KVLYKDTKKQYDSINFKAEVEGTYKACFSNEFSTFSHKIV------------YMDWQFGDQNALH 118

  Fly   129 QATVQ-----SMINQLSAKLG-AVKMEQEYM-HFRYR---GHLEVSDMVELRVLAWSIFGPMMLI 183
            .|..|     :.:...:..:| .::...:|. |.|.|   |.....::.| ||:.||:....:::
 Worm   119 AAVTQGAHAMTQLENYAVAIGDKLRTIDDYQTHHRLREATGRKRAEELNE-RVMIWSLGQSAVVV 182

  Fly   184 ITAVLEVYYLKHFFEVKR 201
            ...:.:|:.||.||..||
 Worm   183 FIGIGQVFLLKSFFNDKR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 46/190 (24%)
tmed-3NP_491892.1 EMP24_GP25L 19..197 CDD:366467 46/190 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.