DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9308 and TMED2

DIOPT Version :9

Sequence 1:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001308374.1 Gene:TMED2 / 10959 HGNCID:16996 Length:208 Species:Homo sapiens


Alignment Length:201 Identity:80/201 - (39%)
Similarity:120/201 - (59%) Gaps:2/201 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVLVLFQAACGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDRLHHS 69
            :||:..|.....|:.|::|||...||::......|:.:.|||.||||.|:.|||.|||:..::..
Human     8 LVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKG 72

  Fly    70 KQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDV--IEQATV 132
            .:::.|.:||.|..:|.|:.||.|:||||||||:||...:..|.:.....::...|.  ..|..:
Human    73 DRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEGGGDTWDAHQNKL 137

  Fly   133 QSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAWSIFGPMMLIITAVLEVYYLKHFF 197
            :.|||:|:..:.|||.|||||..|.|.|..::|....||:.||.|..::|:...:.::||||.||
Human   138 EEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFF 202

  Fly   198 EVKRVV 203
            ||:|||
Human   203 EVRRVV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 71/182 (39%)
TMED2NP_001308374.1 EMP24_GP25L 23..203 CDD:366467 70/179 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53803
OrthoDB 1 1.010 - - D1328081at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101558
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.