DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEAR1 and NimC3

DIOPT Version :9

Sequence 1:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens
Sequence 2:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster


Alignment Length:150 Identity:39/150 - (26%)
Similarity:54/150 - (36%) Gaps:46/150 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   163 VYRQVVKTDHRQRLQCCHGFYESR-GFCVPLCAQEC-VHGRCVAPNQCQCVPGWRGDD------- 218
            ||.:.|:.|:.|  .||.|:.... |||.|:|.:.| .|..|..|::|.|..|:....       
  Fly    68 VYEERVRWDNIQ--VCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQ 130

Human   219 --CSSECAPGMWGPQCDKPCSCGNNSSCDPKSGVCSCPSGLQPPNCLQPCTPGYYGPACQF---- 277
              |...|..|     |.:...|..::.|:                    |.||:...:..|    
  Fly   131 LICRPVCQGG-----CPEHSHCVAHNECE--------------------CWPGFKDASSWFSLSL 170

Human   278 RC---QC-HGAPCDPQTGAC 293
            ||   || |....||...||
  Fly   171 RCERVQCGHEQRFDPGRRAC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEAR1XP_016856723.1 None
NimC3NP_524928.2 MSC 85..>212 CDD:286487 30/130 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.