DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEAR1 and CG17147

DIOPT Version :9

Sequence 1:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:301 Identity:67/301 - (22%)
Similarity:91/301 - (30%) Gaps:83/301 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   303 SCD--VSCSQGTSGFF-CPSTHSCQNGGVFQTPQGSCSCPPGWMGTICSLPCPEGFHGPNCSQEC 364
            :||  :.|..|..... |||..|      |...:|||..........|...| ||..|...:...
  Fly    46 TCDQYIQCYDGNGTVLTCPSNQS------FNPSKGSCVDTLANSNKYCGNRC-EGLDGEWVADPT 103

Human   365 RCHNGGLCDRFTGQCRCAPGYTGDRCREECPVGRFGQDCAETCDCAPDARCFPANGACL------ 423
            .||....|            ..|......||||:...:.:::|....|:.|...|..|.      
  Fly   104 ECHKYFYC------------MNGVPLAGMCPVGQHFDERSQSCLYGVDSMCVDVNNICELVAENT 156

Human   424 -------CEHGFTGDRCTDRLCPDGFYGLSCQAPCTC---DREH----SLSCHPMNG-ECSCLPG 473
                   |.:.:..|:.          |......||.   .||:    |.:|...|. ||:.   
  Fly   157 KFRNEKDCAYYYECDKT----------GNHASKSCTVTSKKREYFDVESGNCVEANKVECTA--- 208

Human   474 WAGLHCNES-CPQDTHGPGCQEHCLCLHGGVCQATSGLC-------QCAPGYTGPHCASLCPPDT 530
                |..|: |...|......:...|....||:|...:.       ||..||.......||...|
  Fly   209 ----HSKENVCTSSTTMTFKSDQATCRGYFVCKALYPVADLDPLWTQCPEGYFFDEDRQLCANPT 269

Human   531 YGVNCSARC-------------SCENAIACSPIDGECVCKE 558
            ..|....||             :|.|.|.|  :|.:.|.:|
  Fly   270 TVVCTHNRCDGRGTMLVTSSSNNCHNYIRC--VDNKEVTEE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEAR1XP_016856723.1 None
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 11/36 (31%)
ChtBD2 89..136 CDD:214696 13/59 (22%)
CBM_14 278..332 CDD:279884 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.