DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEAR1 and CG5883

DIOPT Version :9

Sequence 1:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:465 Identity:88/465 - (18%)
Similarity:134/465 - (28%) Gaps:201/465 - (43%)


- Green bases have known domain annotations that are detailed below.


Human   229 GPQCDKPCSCGNNSSC---DPKSGVCSCPSGLQPPNCLQPCTPGYYGPACQFRCQCHGAPCDPQT 290
            |.|..||.||..:..|   :...|: :| ||.:|          ||..:               .
  Fly    41 GTQLLKPGSCSESIICQNFESTPGI-TC-SGSKP----------YYSKS---------------K 78

Human   291 GACFCPAERTGPSCDVSCSQGTSGFFCPSTHSCQNGGVFQTPQGSCSCPPGWMG-TICSLPCPEG 354
            |:|                |.::..:|.::..|:..|.            |::| ||        
  Fly    79 GSC----------------QASADTYCDTSKICKGSGT------------GYIGDTI-------- 107

Human   355 FHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGDRCREECPVGRFGQD--CA---ETCDCAPDAR 414
                ||:....|.    .|...|:..|..|...|:..:.|.   :.:|  ||   |.||.||...
  Fly   108 ----NCANWYYCD----ADALLGKGTCNLGMYFDQVSKSCV---YSEDTVCAAKYEICDVAPVGT 161

Human   415 CFPANGACLCEHGFTGDRCTDRLCPDG-FYGLSCQAPCTCDREHSLSC--HPMNGECSCLPGWAG 476
            .|..:..|...:..:.....:..|.:| :|.:   |..||.|:..:.|  ||:..|.        
  Fly   162 PFRDDANCHKYYTCSSKSLVENTCENGLYYNV---ATGTCVRKKDVICENHPLPDEV-------- 215

Human   477 LHCNESCPQDTHGPGCQEHCLCLHGGVCQATSGLCQCAPGYTGPHCASLCP--PDTYGVNCSARC 539
                           |....|.:..   :..|.:..|...|   :|..|..  |||         
  Fly   216 ---------------CGNKKLAVRN---KFVSDMATCRGYY---YCRDLGSGIPDT--------- 250

Human   540 SCENAIACSPIDGECVCKEGWQRGNCSVPCPPGTWGFSCNASCQCAHEAVCSPQTGACTCTPGWH 604
                    .||         :|                     ||......:.:..||       
  Fly   251 --------DPI---------YQ---------------------QCDENNFFNQERQAC------- 270

Human   605 GAHCQLPCPKGQFGEGCASRCDCDHSDG---------CDPVHGRCQCQAGWMGARCHLSCPEGLW 660
                   .|:.      :.:||.|..||         .|..|...:|..|  .....:||.:..:
  Fly   271 -------MPRE------SQKCDYDRCDGRKDGFEVAEIDGCHHYIECVDG--RETTPISCEDKYF 320

Human   661 GV---NCSNT 667
            .|   |||:|
  Fly   321 DVVTQNCSST 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEAR1XP_016856723.1 None
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 16/81 (20%)
CBM_14 154..204 CDD:279884 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.