DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEAR1 and CG15861

DIOPT Version :9

Sequence 1:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens
Sequence 2:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster


Alignment Length:250 Identity:56/250 - (22%)
Similarity:69/250 - (27%) Gaps:120/250 - (48%)


- Green bases have known domain annotations that are detailed below.


Human   189 CVPLCAQECVHGRCVAPNQCQCVPGWRGDD-----CSSECAPGMWGPQCDKPCSCGNNSSCDPKS 248
            ||..|...|::|.|.....|.|...:...:     |::||.||                 |....
  Fly    49 CVRRCNIVCLNGVCFEDGSCPCADQYMAGNPDGLVCAAECLPG-----------------CVAAG 96

Human   249 GVCSCPSGLQPPNCLQPCTPG---YYGPACQFRCQCHGAP--CDPQTGACFCPAERTGPSCDVSC 308
            |.|:.|.       |..|...   |:.|..| :|: |.||  .||..|.|               
  Fly    97 GYCAAPD-------LCVCREDRHYYFDPLSQ-KCR-HRAPRLLDPCLGRC--------------- 137

Human   309 SQGTSGFFCPSTHSCQNGGVFQTPQGSCSCPPGWMGTICSLPCPEGFHGPNCSQECRCHNGGLCD 373
                       ||.                                    |||.:          
  Fly   138 -----------THG------------------------------------NCSSD---------- 145

Human   374 RFTGQCRCAPGYTGDRCREECPVGRFGQDCAETCD--CAPDARCFPANGACLCEH 426
               |:|.||.||   ..|:..   ..||.|...||  |.|.|.||..| .|.|.|
  Fly   146 ---GRCICAQGY---ELRDSL---LHGQQCMPICDHNCGPRAYCFAPN-LCACRH 190



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.