DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEAR1 and NimB5

DIOPT Version :9

Sequence 1:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens
Sequence 2:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster


Alignment Length:329 Identity:90/329 - (27%)
Similarity:122/329 - (37%) Gaps:97/329 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   112 PTPAPSACSPQSPASGPGRAPILAPSPQTQRKLLASRDSF-CMVCV--GVVYRTVYRQVVKTDHR 173
            |.|| :...|::....|.|...|..|.:||    :.|... |.:.|  ..|.:..|..|::||..
  Fly    62 PGPA-NFQDPRNVELQPKRREYLIRSHETQ----SDRGQHKCRIWVPPDTVEKYSYPSVIQTDQA 121

Human   174 QRLQ----CCHGFYESRGFCVPLCAQE--CVHGRCVAPNQCQCVPGWRGDDCSSECAPGMWGPQC 232
            .||.    ||.|:..||...|.:|..:  |.:|.|..|.:|:|..|:..:|              
  Fly   122 NRLSLIEVCCTGYSASRLMGVTVCRAQCGCQNGSCKIPGECECYDGFVRND-------------- 172

Human   233 DKPCSCGNNSSCDPKSGVCSCPSGLQPPNCLQPCTPGYYGPACQFRCQCHGAPCDPQTGACFCPA 297
                    |..|     |.:||.|.|...|       |...:||         |||.     ...
  Fly   173 --------NGDC-----VFACPLGCQNGQC-------YLDGSCQ---------CDPG-----YKL 203

Human   298 ERTGPSCDVSCSQGTSGFFCPST--HSCQNGGVFQTPQGSCSCPPGWMGTICSLPCPEGFHGPNC 360
            :.|...|...||.|     |.|:  |:|       |....|.|..|:..|      .:|.. |.|
  Fly   204 DETRRFCRPICSSG-----CGSSPRHNC-------TEPEICGCSKGYQLT------DDGCQ-PVC 249

Human   361 SQECRCHNGGLCDRFTGQCRCAPGYTGDRCREECPVGRFGQDCAETCDCAPDARCFPANGACLCE 425
            ..:|..  |||| :...||.|||||   ..|:    |....||.:.|:   :..|...| .|||:
  Fly   250 EPDCGI--GGLC-KDNNQCDCAPGY---NLRD----GVCQADCYQKCN---NGVCVSRN-RCLCD 300

Human   426 HGFT 429
            .|:|
  Fly   301 PGYT 304



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.