DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEAR1 and NimA

DIOPT Version :9

Sequence 1:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:218 Identity:69/218 - (31%)
Similarity:100/218 - (45%) Gaps:26/218 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    88 LELSTPVIPIPAASGKASLPPPRSPTPAPSACSPQSPASGPGRAPILAPSPQTQRKLLASRDSFC 152
            |:::|.|..|.|  |..:||..:.|   .:.|..:.|.....:.|.:.|       :.....|:|
  Fly    28 LKINTNVKDIEA--GVVALPSIQGP---GNICIREEPYVEHVQVPEMQP-------VRVRTSSWC 80

Human   153 MV----CVGVVYRTVYRQVVKTDHRQRLQ----CCHGF----YESRGFCVPLCAQECVHGRCVAP 205
            |.    |  ..::|..|:|::.....:.:    ||.|:    .:|:..|.|:|...|..|.||.|
  Fly    81 MEIPPRC--ATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMP 143

Human   206 NQCQCVPGWRGDDCSSECAPGMWGPQCDKPCSCGNNSSCDPKSGVCSCPSGLQPPNCLQPCTPGY 270
            :.|.|..|:.|..|:..|....||..|...|.|.|.::||.|||:|.|.:|.....|..||..|.
  Fly   144 DICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGT 208

Human   271 YGPACQFRCQCHGAPCDPQTGAC 293
            ||..|:..|.|...||:||||||
  Fly   209 YGIMCRKACDCDEKPCNPQTGAC 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEAR1XP_016856723.1 None
NimANP_001285918.1 EMI 52..116 CDD:284877 13/72 (18%)
EGF_2 170..200 CDD:285248 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24052
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.