DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEAR1 and NimB2

DIOPT Version :9

Sequence 1:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:435 Identity:110/435 - (25%)
Similarity:144/435 - (33%) Gaps:165/435 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   124 PASGPGRAPILAPSPQTQ------------RKLLASRDSFCMVCVGVVYRTVYRQVV---KTDHR 173
            |..|....|:..|:.:.|            |..:||...:..|....:.|....|.|   .|...
  Fly    97 PLYGHYVQPVTPPAHRVQVLDETALFINKTRSAMASGVCYKEVPTASLLRNSRDQFVGNGTTPDM 161

Human   174 QRLQ-CCHGFYESRGF---CVPLCAQECVHGRCVAPNQCQCVPG---WRGDDCSSECAPGMWGPQ 231
            .|:| ||.|:..:...   |.|:||.:|.:|.|.|||.|.|:||   .....|.|.|        
  Fly   162 SRIQVCCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPGHVRTAEGKCISTC-------- 218

Human   232 CDKPCSCGNNSSCDPKSGVCSCPSG--LQPPN---CLQPCTPGYYGPACQF-RCQCHGAPCDPQT 290
               |..|| |..||.:: .|.|..|  |:|..   |...|.||     |.| ||..      |..
  Fly   219 ---PLGCG-NGVCDERN-ECKCREGYSLEPETRKYCQPECKPG-----CSFGRCVA------PNK 267

Human   291 GACFCPAERTGPSCDVSCSQGTSGFFCPSTHSCQNGGVFQTPQGSCSCPPGWM------GTICSL 349
            .||.   :....:.|.||.        |...||:||..  |..|.|:|..|::      ..|||:
  Fly   268 CACL---DGYRLAADGSCE--------PVCDSCENGKC--TAPGHCNCNAGYLKLQGRCEPICSI 319

Human   350 PCPEGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGDRCREECPVGRFGQDCAETCDCAP--D 412
            ||..|          ||....:|:       ||.|:..||               ::.:|.|  |
  Fly   320 PCKNG----------RCIGPDICE-------CASGFEWDR---------------KSAECLPKCD 352

Human   413 ARCFPANGACLCEHGFTGDRCTDRLCPDGFYGLSCQAPCTCDREHSLSCHPMNGECSCLPGWA-G 476
            ..|.  ||.|:                                        .|.:|.|..|:. .
  Fly   353 LPCL--NGVCV----------------------------------------GNNQCDCKTGYVRD 375

Human   477 LH----CNESCPQDTHGPGCQEHCLCLHGGVCQATSGLCQCAPGY 517
            .|    |...|||     |||       .|.|.|.: .|.|.||:
  Fly   376 EHQRNICQPHCPQ-----GCQ-------NGYCSAPN-FCICRPGF 407



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.