DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58b and Gr63a

DIOPT Version :9

Sequence 1:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:367 Identity:76/367 - (20%)
Similarity:138/367 - (37%) Gaps:73/367 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IYSFFVGIFLFLNLYFMVPRIMEDGYMKYNIV-----LQWNF----FVMLFLRAIAVVSCYGTLW 102
            |||  |..|:.|..|.        ||:..|.:     |...|    ...|||..|..:.....||
  Fly   110 IYS--VVFFVLLACYV--------GYVANNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPILW 164

  Fly   103 LKRHKIIQLYK----YSLIYWKRFGHITRAIVDKKELLDLQESLARIMIRKIILLYSAFLCSTVL 163
            .:..||.:|:.    :.::|::..||            .|...|.:..:...|:|....:.|.|:
  Fly   165 YEARKIAKLFNDWDDFEVLYYQISGH------------SLPLKLRQKAVYIAIVLPILSVLSVVI 217

  Fly   164 QYQLLSVINPQIFLAFCARLTHFLHFLCVKMGFFGVLVLLNHQFLVIHLAINALHGRKARKKWKA 228
            .:..:|.:|....:.:|     .|..|...:|.:..|: .....:..||.        |.:..||
  Fly   218 THVTMSDLNINQVVPYC-----ILDNLTAMLGAWWFLI-CEAMSITAHLL--------AERFQKA 268

  Fly   229 LRSV--AAM-------HLKTLRLARRIFDMFDIANATVFINMFMTAINILYHAVQ---YSNSSIK 281
            |:.:  |||       .|:..:|.|      |..||..:..:||:.  .|:..:.   |...|..
  Fly   269 LKHIGPAAMVADYRVLWLRLSKLTR------DTGNALCYTFVFMSL--YLFFIITLSIYGLMSQL 325

  Fly   282 SNGWGILFGNGLIVFNFWGTMALMEMLDSVVTSCNNTGQQLRQ---LSDLPKVGPKMQRELDVFT 343
            |.|:||. ..||.:...|....|..:.|....:..|.....::   :.:|..:....|.|:::|.
  Fly   326 SEGFGIK-DIGLTITALWNIGLLFYICDEAHYASVNVRTNFQKKLLMVELNWMNSDAQTEINMFL 389

  Fly   344 MQLRQNRLVYKICGIVELDKPACLSYIGSILSNVIILMQFDL 385
            .....|.......|..::::......:.::::.:::|:||.:
  Fly   390 RATEMNPSTINCGGFFDVNRTLFKGLLTTMVTYLVVLLQFQI 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 76/365 (21%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 76/367 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.