DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58b and Gr9a

DIOPT Version :9

Sequence 1:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:364 Identity:69/364 - (18%)
Similarity:137/364 - (37%) Gaps:73/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FLNLYFMVPRIMEDGYMKYNIVLQWN-----------FFVMLFLRAIAVVSCYGTLWLKRHKIIQ 110
            ||..||.:          ..:|..|:           |.|::.:..:..:..|.|.....::.:.
  Fly     8 FLTGYFQL----------CGLVCGWSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDNESVP 62

  Fly   111 LY----------KYSLIY-W---------KRFGHITRAIVDKKELLDLQESLARIMIRKIILLYS 155
            .|          .|.:|: |         :||    |.::::...:.....:.|.:|.:|||   
  Fly    63 AYFAKVIMGVNMAYKMIHAWIALSALFECRRF----RYLLEELPPVKATSFIYRHLILEIIL--- 120

  Fly   156 AFLCSTVL---QYQLLSVINPQIFLAFCARLTHFLHFLCVKMGFFGVLVLLNHQFLVIHLAINAL 217
             |.|:..|   :|.:..:        :...|.:......|:..:..::||::.    :...:..|
  Fly   121 -FACNAFLVLSEYTIRGI--------YLENLRYAYSLQAVRARYLQMMVLVDR----LDGKLEQL 172

  Fly   218 HGR--KARKKWKALRSVAAMHLKTLRLARRIFDMFDIANATVFINMFMTAINILYHAVQYSNSSI 280
            |.|  .....:|.||...|...|..|....:|.:..:....:.:..::...|: |..|.|.....
  Fly   173 HHRVISGSSDYKTLRLDYAHLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCNV-YFMVAYLQVLP 236

  Fly   281 KSNGWGILFGNGLIVFNFWGTMALMEMLDSVVTSCNNTGQQL-RQLSDLPKVGPKMQRELDVFTM 344
            .:     ||..|.::|....|:..:..:.:....|.:..:.| :||.|||...|..:.:::.|.:
  Fly   237 AT-----LFLFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFAL 296

  Fly   345 QLRQNRLVYKICGIVELDKPACLSYIGSILSNVIILMQF 383
            |:.|:.:...:|||..|:..........||..::|.:||
  Fly   297 QIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 69/364 (19%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 67/362 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.