DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58b and egl-47

DIOPT Version :9

Sequence 1:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001023728.1 Gene:egl-47 / 183687 WormBaseID:WBGene00001211 Length:522 Species:Caenorhabditis elegans


Alignment Length:222 Identity:44/222 - (19%)
Similarity:83/222 - (37%) Gaps:73/222 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SLIYWKRFGHITRAIVDKKELLDLQESLARIMIRKIILLYSAFLCSTVLQYQLLSVINPQIFLAF 179
            |:::..|...|..|..|:|   ..::...|.:|:  ::||        :.|.:|:|:        
 Worm   112 SILFLFRLLAIFPATTDRK---SRRKRNHRSIIK--LILY--------VNYIVLAVL-------- 155

  Fly   180 CARLTHFLHFLCVKMGFFGVLVLLNHQFLVIHL------------AINALHGRKARKKWKALRSV 232
               |..||    :||. |.||:|..|:|.::|.            .||..           :..:
 Worm   156 ---LNSFL----IKMN-FKVLMLYKHKFGLMHTGTVASMITATKPVINVF-----------VIVL 201

  Fly   233 AAMHLKTLRLARRIFDMFDIANATVF----------INMFMTAINILYHAVQYSNSSIKSNGWGI 287
            :|:..|:.:...:..||.|:...:.|          ...|.|.:.|.:.|:..  ..::..|.|.
 Worm   202 SAIKFKSHQRLLKTIDMVDVCFRSAFGVSPPLRIYKFVFFFTLLIIFFSALIL--KVVEFVGTGE 264

  Fly   288 LFGNGLI---------VFNFWGTMALM 305
            :||..::         |.:.|..:.|:
 Worm   265 IFGEHILTDCSFILVPVLSLWNIIPLL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 44/222 (20%)
egl-47NP_001023728.1 7tm_7 110..495 CDD:303125 44/222 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.